MrVIA precursor (P04528) Protein Card

General Information
Name MrVIA precursor
Alternative name(s) Mr053,Mr6.5
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTLVMA
DDSNNGLANHFSKSRDEME
DPEASKLEKR
ACRKKWEYCIVPIIGFIYCCPGLICGPFVCV
Sequence region
[1-22]signal sequence
[52-82]mature peptideMrVIA

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies. BMC Genomics 14:708

Internal links
Nucleic acids MrVIA (Mr6.5) mRNA, complete cds.
Structure

External links
Ncbi BAO02208 (partial), BAO02218 (partial), ADZ74146

Tools