Eu14.1 precursor (P04534) Protein Card

General Information
Name Eu14.1 precursor (named by ConoServer)
Alternative name(s) Eb14.1
Organism Conus eburneus
Organism diet piscivorous
Protein Type Precursor
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb14.1" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was rename "Eu14.1".

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MTSVQSVTCCCLLWLMLSLTLVTP
GSPGPAQLPGHRAAR
VP
AEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
RKRS
MAV
Sequence region
[1-24]signal sequence
[40-78]mature peptideEu14.1

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Nucleic acids Conus eburneus conotoxin Eb14.1 mRNA, complete cds.
Structure

External links
Ncbi ADZ74152

Tools