Lt14.5 precursor (P04537) Protein Card

General Information
Name Lt14.5 precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVRSVTCCCLLWLMLSLTLVTP
GSPGPAQLPGHRAAR
VP
AEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
RKRS
MAV
Sequence region
[1-24]signal sequence
[40-78]mature peptideLt14.5

References

Internal links
Nucleic acids Lt14.5 precursor, mRNA, complete cds.
Structure

External links
Ncbi ADZ74180

Tools