Lt15.6 precursor (P04542) Protein Card

General Information
Name Lt15.6 precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Pharmacological family

Sequence
MPKLEMMLLVLLILPLCYIDA
VGPLPPWNMEDEIIEHWQK
L
HCYEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPACTCP
PCL
Sequence region
[1-21]signal sequence
[41-85]mature peptideLt15.6

References

Internal links
Nucleic acids Conus litteratus conotoxin Lt15.6 mRNA, complete cds.
Structure

External links
Ncbi ADZ76486

Tools