Lt15.5 precursor (P04546) Protein Card

General Information
Name Lt15.5 precursor
Alternative name(s) Lt15.6c
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Pharmacological family

Sequence
MPKLEMMLLVLLILPLCYIDA
VGPPPPWNMEDEIIEHWQE
L
HCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPVCTCP
PCL
Sequence region
[1-21]signal sequence
[41-85]mature peptideLt15.5

References

Internal links
Nucleic acids Lt15.5 mRNA, complete cds.
Structure

External links
Ncbi ADZ76490

Tools