Conantokin-Eu2 precursor (P04568) Protein Card

General Information
Name Conantokin-Eu2 precursor
Alternative name(s) Conantoking-L-like
Organism Conus eburneus
Organism diet generalist
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily
Pharmacological family

Sequence
MQSFTCMCLLVPLLLFFHLTQVSD
TADHGGAATDVRSADRT
LKRFPHDFRRAPKRRSDGHYDRNRKTSVQLDTELLVEGVRE
GQEERAEASYEKLLEI
GR
Sequence region
[1-24]signal sequence
[83-98]mature peptideConantokin-Eu2

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Nucleic acids conantokin-E2 mRNA, complete cds.
Structure

External links
Ncbi ADZ99323

Tools