Eu6.6 precursor (P04572) Protein Card

General Information
Name Eu6.6 precursor (named by ConoServer)
Alternative name(s) Eb6.6
Organism Conus eburneus
Organism diet piscivorous
Protein Type Precursor
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb6.6" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was rename "Eu6.6".

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGIMVLTLLLLVFMATSHQ
HRGGKQLMLRNNLQKR
TCS
SPSNCPTGQECCPDKVDEPEGFCADECIIT
Sequence region
[1-22]signal sequence
[39-71]mature peptideEu6.6

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Nucleic acids Conus eburneus conotoxin Eb6.6 mRNA, complete cds.
Structure

External links
Ncbi ADZ99332

Tools