Bu15 precursor (P04594) Protein Card

General Information
Name Bu15 precursor
Organism Conus bullatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MLKMGVLLFTFLVLFPLATLQLDA
DQPVERYADNKQDLNPD
ER
MIFLFGGCCRMSSCQPPPVCNCCAKQDLNPDER
Sequence region
[1-24]signal sequence
[25-43]pro region
[44-76]mature peptideBu15

References
Hu,H., Bandyopadhyay,P.K. and Yandell,M. (2011) Characterization of the Conus bullatus genome and its venom-duct transcriptome. BMC Genomics 12:60

Internal links
Nucleic acids
Structure

External links
Ncbi P0CY73

Tools