Bu11 (P04601) Protein Card

General Information
Name Bu11
Organism Conus bullatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Bu11 precursor (4600)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
STSCVEAGSYCRPNVKLCCGFCSPYSKICMNFPKN
Sequence evidence nucleic acid level
Average Mass 3832.44
Monoisotopic Mass 3829.63
Isoelectric Point 11.36
Extinction Coefficient [280nm] 2980.00

References
Hu,H., Bandyopadhyay,P.K. and Yandell,M. (2011) Characterization of the Conus bullatus genome and its venom-duct transcriptome. BMC Genomics 12:60

Internal links
Protein Precursor Bu11 precursor (4600)
Nucleic acids
Structure

External links

Tools