Bu12 (P04603) Protein Card

General Information
Name Bu12
Organism Conus bullatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Bu12 precursor (4602)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CITPGTRCKVPSQCCRGPCKNGRCTPSPSEW
Sequence evidence nucleic acid level
Average Mass 3346.85
Monoisotopic Mass 3344.45
Isoelectric Point 12.29
Extinction Coefficient [280nm] 5500.00

References
Hu,H., Bandyopadhyay,P.K. and Yandell,M. (2011) Characterization of the Conus bullatus genome and its venom-duct transcriptome. BMC Genomics 12:60

Internal links
Protein Precursor Bu12 precursor (4602)
Nucleic acids
Structure

External links

Tools