Bu14 (P04607) Protein Card

General Information
Name Bu14
Organism Conus bullatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Bu14 precursor (4606)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CSEGGDFCSKNSECCDKKCQDEGEGRGVCLIVPQNVILLH
Sequence evidence nucleic acid level
Average Mass 4308.82
Monoisotopic Mass 4305.87
Isoelectric Point 4.89
Extinction Coefficient [280nm] 750.00

References
Hu,H., Bandyopadhyay,P.K. and Yandell,M. (2011) Characterization of the Conus bullatus genome and its venom-duct transcriptome. BMC Genomics 12:60

Internal links
Protein Precursor Bu14 precursor (4606)
Nucleic acids
Structure

External links

Tools