Bu5 precursor (P04615) Protein Card

General Information
Name Bu5 precursor
Organism Conus bullatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIVAVLFLTACQLATA
ENSREEQGYSAVRSSDQIQ
DSDLKLTK
SCTDDFEPCEAGFENCCSKSCFEFEDVYVC
GVS
IDYYDSR
Sequence region
[1-22]signal sequence
[50-79]mature peptideBu5

References
Hu,H., Bandyopadhyay,P.K. and Yandell,M. (2011) Characterization of the Conus bullatus genome and its venom-duct transcriptome. BMC Genomics 12:60

Internal links
Nucleic acids
Structure

External links
Ncbi P0CY64

Tools