Bu5 (P04616) Protein Card

General Information
Name Bu5
Organism Conus bullatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Bu5 precursor (4615)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
SCTDDFEPCEAGFENCCSKSCFEFEDVYVC(nh2)
Modified residues
positionsymbolname
31nh2C-term amidation
Sequence evidence nucleic acid level
Average Mass 3400.65
Monoisotopic Mass 3398.19
Isoelectric Point 4.02
Extinction Coefficient [280nm] 1490.00

References
Hu,H., Bandyopadhyay,P.K. and Yandell,M. (2011) Characterization of the Conus bullatus genome and its venom-duct transcriptome. BMC Genomics 12:60

Internal links
Protein Precursor Bu5 precursor (4615)
Nucleic acids
Structure

External links

Tools