Lt14.3 (P04632) Protein Card

General Information
Name Lt14.3
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt14.3 precursor (4539)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
VPAEPILEQLCPEMCNRGELEFFCTCGSRQFVVTLPVIE
Sequence evidence nucleic acid level
Average Mass 4395.12
Monoisotopic Mass 4392.08
Isoelectric Point 4.20
Extinction Coefficient [280nm] -1.00

References

Internal links
Protein Precursor Lt14.3 precursor (4539)
Nucleic acids
Structure

External links

Tools