Lt14.3 (P04632) Protein Card

General Information
Name Lt14.3
Alternative name(s) Lt076
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt14.3 precursor (4539)
Lt14.3 precursor (9820)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
VPAEPILEQLCPEMCNRGELEFFCTCGSRQFVVTLPVIE
Sequence evidence nucleic acid level
Average Mass 4395.12
Monoisotopic Mass 4392.08
Isoelectric Point 4.20
Extinction Coefficient [280nm] -1.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Lt14.3 precursor (4539)
Lt14.3 precursor (9820)
Nucleic acids
Structure

External links

Tools