Lt14.2 (P04634) Protein Card

General Information
Name Lt14.2
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt14.2 precursor (4537)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
VPAEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
Sequence evidence nucleic acid level
Average Mass 4222.84
Monoisotopic Mass 4219.93
Isoelectric Point 3.73
Extinction Coefficient [280nm] -1.00

References

Internal links
Protein Precursor Lt14.2 precursor (4537)
Nucleic acids
Structure

External links

Tools