Im9.11 (P04649) Protein Card

General Information
Name Im9.11
Alternative name(s) Im5.3
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im9.11 precursor (4525)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
CIVGTPCHVCRSQSKSCNGWLGKQRYCGYC
Sequence evidence nucleic acid level
Average Mass 3331.84
Monoisotopic Mass 3329.42
Isoelectric Point 12.58
Extinction Coefficient [280nm] 8480.00

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Protein Precursor Im9.11 precursor (4525)
Nucleic acids
Structure

External links

Tools