Im6.6 (P04650) Protein Card

General Information
Name Im6.6
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im6.6 precursor (4524)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
SSTYDDEIATFCWSYWIGFQYSYPYTYVQPCTALGKACTAN
SDCCSKYCNTKICKINWE
Sequence evidence nucleic acid level
Average Mass 6830.60
Monoisotopic Mass 6825.90
Isoelectric Point 7.16
Extinction Coefficient [280nm] 27055.00

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Protein Precursor Im6.6 precursor (4524)
Nucleic acids
Structure

External links

Tools