Lt28.3 (P04655) Protein Card

General Information
Name Lt28.3
Alternative name(s) Lt15.6
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt28.3 precursor (4542)

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XXVIII
Pharmacological family

Sequence
LHCYEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPACTC
PPCL
Sequence evidence nucleic acid level
Average Mass 4707.42
Monoisotopic Mass 4703.88
Isoelectric Point 4.67
Extinction Coefficient [280nm] 6990.00

References
Lu, J., Zhang, K., Wang, S., Sun, T., Yu, S., Dai, Q. and Liu, Z. (2017) Cloning, expression and functional characterization of a D-superfamily conotoxin Lt28. 1 with previously undescribed cysteine pattern Peptides, 94, pp.64-70 94:64-70

Internal links
Protein Precursor Lt28.3 precursor (4542)
Nucleic acids
Structure

External links

Tools