Lt3.6 (P04658) Protein Card

General Information
Name Lt3.6
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt3.6 precursor (4557)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Cysteine framework III
Pharmacological family

Sequence
MQGKISSEQHPMFDPIEGCCTQSCTTCFPCCLI
Sequence evidence nucleic acid level
Average Mass 3633.19
Monoisotopic Mass 3630.46
Isoelectric Point 4.80
Extinction Coefficient [280nm] -1.00

References

Internal links
Protein Precursor Lt3.6 precursor (4557)
Nucleic acids
Structure

External links

Tools