Vi1.7 (P04669) Protein Card

General Information
Name Vi1.7
Alternative name(s) Vi1.6
Organism Conus virgo
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Vi1.7 precursor (4547)
Notes The associated peptide was submitted to NCBI with the name Vi1.6 but a peptide with the same name and same species was already submitted (by the same authors). The peptide was therefore renamed Vi1.7.

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
NAAAKAFGLITPTVRKGCCSNPACMLKNPNLC
Sequence evidence nucleic acid level
Average Mass 3303.94
Monoisotopic Mass 3301.60
Isoelectric Point 12.09
Extinction Coefficient [280nm] -1.00

References

Internal links
Protein Precursor Vi1.7 precursor (4547)
Nucleic acids
Structure

External links

Tools