Eb3-KP04 precursor (P04848) Protein Card

General Information
Name Eb3-KP04 precursor
Organism Conus ebraeus
Organism region Indo-Pacific,Eastern Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADRPAERLQDDIS
SEHHPMFDAVKRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
Sequence region
[1-22]signal sequence
[75-89]mature peptideEb3-KP04

References

Internal links
Nucleic acids Conus ebraeus M superfamily MMSK group conopeptide Eb3-KP06 mRNA, complete cds.
Structure

External links
Ncbi AEX60313

Tools