Rt3-KP01 precursor (P04870) Protein Card

General Information
Name Rt3-KP01 precursor
Organism Conus rattus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MMSKLGVLLTICLLLFPHTAVP
LDGDQPADQPAERLQDDIS
SEHHPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
Sequence region
[1-22]signal sequence
[75-89]mature peptideRt3-KP01

References

Internal links
Nucleic acids Conus rattus M superfamily MMSK group conopeptide Rt+Tx+Vr+S3-KP01 mRNA, complete cds.
Structure

External links
Ncbi AEX60367

Tools