Ca3-KP02 precursor (P04889) Protein Card

General Information
Name Ca3-KP02 precursor
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAERLQDDIS
SENNPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
Sequence region
[1-20]signal sequence
[75-89]mature peptideCa3-KP02

References

Internal links
Nucleic acids Conus caracteristicus M superfamily MMSK group conopeptide Ca3-KP02 mRNA, complete cds.
Structure

External links
Ncbi AEX60397

Tools