S3-KP02 precursor (P04890) Protein Card

General Information
Name S3-KP02 precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADQPAERLQDDIS
SENNPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
Sequence region
[1-22]signal sequence
[75-89]mature peptideS3-KP02

References

Internal links
Nucleic acids Conus striatus M superfamily MMSK group conopeptide S+Eb+Tx+Vt3-KP03 mRNA, complete cds.
Structure

External links
Ncbi AEX60398

Tools