Vt3-KP04 precursor (P04902) Protein Card

General Information
Name Vt3-KP04 precursor
Organism Conus vitulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAERLQDDIS
SEHPMFDAVRRREQNQFKSFTSVKLLDSRGER
CCGPTACLA
GCKPCC
G
Sequence region
[1-20]signal sequence
[74-88]mature peptideVt3-KP04

References

Internal links
Nucleic acids Conus vitulinus M superfamily MMSK group conopeptide Vt3-KP05 mRNA, complete cds.
Structure

External links
Ncbi AEX60422

Tools