Tx3-KP01 precursor (P04903) Protein Card

General Information
Name Tx3-KP01 precursor
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADRPAERMQDDIS
SEHHPMFDAVKRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
Sequence region
[1-22]signal sequence
[75-89]mature peptideTx3-KP01

References

Internal links
Nucleic acids Conus textile M superfamily MMSK group conopeptide Tx3-KP09 mRNA, complete cds.
Structure

External links
Ncbi AEX60424

Tools