Eb2C12 (P05018) Protein Card

General Information
Name Eb2C12
Alternative name(s) Eb2C13,Eb2C14
Organism Conus ebraeus
Organism region Indo-Pacific,Eastern Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Eb2C12 precursor (4794)
Eb2C12 precursor (4811)
Eb2C12 precursor (4812)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class unclassified
Gene superfamily M superfamily
Pharmacological family

Sequence
SCNWSSLCDPPSERMTAFTANNAALELPYSGLVAPEQ
Sequence evidence nucleic acid level
Average Mass 3969.38
Monoisotopic Mass 3966.79
Isoelectric Point 4.50
Extinction Coefficient [280nm] 6990.00

References

Internal links
Protein Precursor Eb2C12 precursor (4794)
Eb2C12 precursor (4811)
Eb2C12 precursor (4812)
Nucleic acids
Structure

External links

Tools