Eb2C11 (P05031) Protein Card

General Information
Name Eb2C11
Organism Conus ebraeus
Organism region Indo-Pacific,Eastern Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Eb2C11 precursor (4813)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class unclassified
Gene superfamily M superfamily
Pharmacological family

Sequence
GIILSALRSPNSCVWSPPCHLPSERMTAFTANNAALELPYS
GLVAPEQ
Sequence evidence nucleic acid level
Average Mass 5108.84
Monoisotopic Mass 5105.52
Isoelectric Point 6.62
Extinction Coefficient [280nm] 6990.00

References

Internal links
Protein Precursor Eb2C11 precursor (4813)
Nucleic acids
Structure

External links

Tools