Rt3-T03 (P05034) Protein Card

General Information
Name Rt3-T03
Organism Conus rattus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Rt3-T03 precursor (4817)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework III
Pharmacological family

Sequence
GCCVKQGCWNVETCTCCPADPYIPKPFPTRST
Sequence evidence nucleic acid level
Average Mass 3500.02
Monoisotopic Mass 3497.48
Isoelectric Point 10.25
Extinction Coefficient [280nm] 6990.00

References

Internal links
Protein Precursor Rt3-T03 precursor (4817)
Nucleic acids
Structure

External links

Tools