Li0.5 precursor (P05179) Protein Card

General Information
Name Li0.5 precursor
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
AANDKASAWTTRTIKQSCCVTPSCTRLYKKVY
GRRH
Sequence region
[1-32]mature peptideLi0.5

References
Chang,D. and Duda,T.F. Jr. (2012) Extensive and continuous duplication facilitates rapid evolution and diversification of gene families. Mol. Biol. Evol. 29:2019-2029

Internal links
Nucleic acids Li0.5 precursor (LIVI_49) gene, partial cds.
Li0.5 precursor (LIVI_50) gene, partial cds.
Structure

External links
Ncbi AFD18514, AFD18512

Tools