Im23a precursor (P05221) Protein Card

General Information
Name Im23a precursor
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily K superfamily
Pharmacological family

Sequence
MIMRMTLTLFVLVVMTAASASG
DALTEAKR
IPYCGQTGAEC
YSWCIKQDLSKDWCCDFVKDIRMNPPADKCP
Sequence region
[1-22]signal sequence
[31-72]mature peptideIm23a

References
Ye,M., Khoo,K.K., Xu,S., Zhou,M., Boonyalai,N., Perugini,M.A., Chi,C., Galea,C.A., Wang,C. and Norton,R.S. (2012) A Helical Conotoxin From Conus Imperialis Has A Novel Cysteine Framework And Defiines A New Superfamily J Biol Chem 287:14973-14983
Puillandre,N., Koua,D., Favreau,P., Olivera,B.M. and Stocklin,R. (2012) Molecular phylogeny, classification and evolution of conopeptides J. Mol. Evol. 74:297-309

Internal links
Nucleic acids
Structure

External links
Ncbi D0PX84

Tools