CnVIIJ (P05235) Protein Card

General Information
Name CnVIIJ
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor CnVIIJ precursor (6160)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
STSCMKAGSYCRSTTRTCCGYCAYFGKFCIDFPSN
Sequence evidence protein level
Average Mass 3854.35
Monoisotopic Mass 3851.54
Isoelectric Point 11.80
Extinction Coefficient [280nm] 4470.00

References
Violette,A., Biass,D., Dutertre,S., Koua,D., Piquemal,D., Pierrat,F. and Favreau,P. (2012) Large-scale discovery of conopeptides and conoproteins in the injectable venom of a fish-hunting cone snail using a combined proteomic and transcriptomic approach. J Proteomics 75:5215-5225

Internal links
Protein Precursor CnVIIJ precursor (6160)
Nucleic acids
Structure

External links
Ncbi P0DKQ6

Tools