Y-Fe1 (P05237) Protein Card

General Information
Name Y-Fe1
Alternative name(s) CPY-Fe1
Organism Conus ferrugineus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Y-Fe1 precursor (5236)

Classification
Conopeptide class conopeptide Y
Gene superfamily
Pharmacological family kappa conotoxin

Sequence
GTYLYPFSYYRLWRYFTRFLHKQPYYYVHI
Sequence evidence protein level
Average Mass 4042.67
Monoisotopic Mass 4040.03
Isoelectric Point 12.81
Extinction Coefficient [280nm] 17420.00

Activity

IC50: Voltage-Gated Potassium Channels

TargetOrganismIC50Ref
Kv1.6H. sapiens8.8uMImperial,J.S. et al. (2008)

References
Imperial,J.S., Chen,P., Sporning,A., Terlau,H., Daly,N.L., Craik,D.J. and Olivera,B.M. (2008) Tyrosine-rich conopeptides affect voltage-gated K+ channels. J. Biol. Chem. 283:23026-23032

Internal links
Protein Precursor Y-Fe1 precursor (5236)
Nucleic acids
Structure

External links

Tools