Unidentified protein (P05240) Protein Card

General Information
Name Unidentified protein
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class unclassified
Gene superfamily
Pharmacological family

Sequence
MKLFMFAAIIFTMASTTVRA
EQCANNRK
VCTWDGQGDTNCD
CIGTACHEDDAHKVSVAGSAFYTCQPISAFRVCDGSEDVMD
AGFSELYCRCSGGSYTISNGEVVCD
Sequence region
[1-20]signal sequence
[29-107]mature peptideprotein

References

Internal links
Nucleic acids
Structure

External links
Ncbi B0L0Y6

Tools