Vi23a (P05341) Protein Card

General Information
Name Vi23a
Organism Conus virgo
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Vi23a precursor (5217)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XXIII
Pharmacological family

Sequence
IPYCGQTGAECYSWCIKQDLSKDWCCDFVKTIARLPPAHIC
SQ
Sequence evidence nucleic acid level
Average Mass 4873.60
Monoisotopic Mass 4870.19
Isoelectric Point 8.37
Extinction Coefficient [280nm] 13980.00

References
Ye,M., Khoo,K.K., Xu,S., Zhou,M., Boonyalai,N., Perugini,M.A., Chi,C., Galea,C.A., Wang,C. and Norton,R.S. (2012) A Helical Conotoxin From Conus Imperialis Has A Novel Cysteine Framework And Defiines A New Superfamily J Biol Chem 287:14973-14983

Internal links
Protein Precursor Vi23a precursor (5217)
Nucleic acids
Structure

External links

Tools