Im23b (P05343) Protein Card

General Information
Name Im23b
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im23b precursor (5222)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily K superfamily
Cysteine framework XXIII
Pharmacological family

Sequence
IPYCGQTGAECYSWCIKQDLSKDWCCDFVKTIARLPPAHIC
SQ
Sequence evidence nucleic acid level
Average Mass 4873.60
Monoisotopic Mass 4870.19
Isoelectric Point 8.37
Extinction Coefficient [280nm] 13980.00

References
Ye,M., Khoo,K.K., Xu,S., Zhou,M., Boonyalai,N., Perugini,M.A., Chi,C., Galea,C.A., Wang,C. and Norton,R.S. (2012) A Helical Conotoxin From Conus Imperialis Has A Novel Cysteine Framework And Defiines A New Superfamily J Biol Chem 287:14973-14983
Puillandre,N., Koua,D., Favreau,P., Olivera,B.M. and Stocklin,R. (2012) Molecular phylogeny, classification and evolution of conopeptides J. Mol. Evol. 74:297-309

Internal links
Protein Precursor Im23b precursor (5222)
Nucleic acids
Structure

External links

Tools