Mr8.1 precursor (P05392) Protein Card

General Information
Name Mr8.1 precursor
Alternative name(s) Mr017
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Pharmacological family

Sequence
CLSFCLLFTLPSSQREEDVQARKTHPKSDFYGTRPRSAER
C
TDSCEFQGVLCRGTCDCYGTNNCYCAINHNKQCICVCTN
Sequence region
[41-80]mature peptideMr8.1

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Nucleic acids
Structure

External links

Tools