Mr6.17 (P05442) Protein Card

General Information
Name Mr6.17
Alternative name(s) Mr052
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr6.17 precursor (5441)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ACRQKWEYCIVPILGFVYCCPGLICGPFVCV
Sequence evidence protein level
Average Mass 3475.23
Monoisotopic Mass 3472.61
Isoelectric Point 10.50
Extinction Coefficient [280nm] 8480.00

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Protein Precursor Mr6.17 precursor (5441)
Nucleic acids
Structure

External links

Tools