Mr6.19 (P05446) Protein Card

General Information
Name Mr6.19
Alternative name(s) Mr055
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr6.19 precursor (5445)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ACRKKWEYCIVPIIGFIYCCPGLICGPFVLRLIGMSSTPIC
ATPGLIFD
Sequence evidence nucleic acid level
Average Mass 5374.56
Monoisotopic Mass 5370.68
Isoelectric Point 11.09
Extinction Coefficient [280nm] 8480.00

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Protein Precursor Mr6.19 precursor (5445)
Nucleic acids
Structure

External links

Tools