Mr14.7 (P05455) Protein Card

General Information
Name Mr14.7
Alternative name(s) Mr060
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr14.7 precursor (5454)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework XIV
Pharmacological family

Sequence
CLDGGEICGICFQAAAVGGALFSSAHETTVMSSTPLCAT(BTr)
LDL
Modified residues
positionsymbolname
40BTrBromotryptophan
Sequence evidence protein level
Average Mass 4422.83
Monoisotopic Mass 4418.87
Isoelectric Point 4.03
Extinction Coefficient [280nm] 5500.00

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Protein Precursor Mr14.7 precursor (5454)
Nucleic acids
Structure

External links

Tools