Mr073 (P05461) Protein Card

General Information
Name Mr073
Alternative name(s) Mr073
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr073 precursor (5460)
Notes The peptide mass was found by MS but it was not sequenced by MS/MS (Dutertre 2013).

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
CIDGGEICDIFFFKLLQWVVHYSCLRMKLP
Sequence evidence protein level
Average Mass 3573.31
Monoisotopic Mass 3570.77
Isoelectric Point 7.79
Extinction Coefficient [280nm] 7115.00

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Protein Precursor Mr073 precursor (5460)
Nucleic acids
Structure

External links

Tools