Mr8.2 (P05493) Protein Card

General Information
Name Mr8.2
Alternative name(s) Mr096
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr8.2 precursor (5492)
Notes The gene superfamily associated with the precursor of this peptide was described as "B superfamily" in Dutertre et al 2013, but this name was already assigned to the conantokin precursors by Puillandre et al. 2012 J Mol Evol, therefore the superfamily was renamed "B2 superfamily".

The peptide mass was found by MS but it was not sequenced by MS/MS (Dutertre 2013).


Classification
Conopeptide class conotoxin
Gene superfamily B2 superfamily
Cysteine framework VIII
Pharmacological family

Sequence
ALVSQCRPCPTCRECKCRECKCRECQCRIHSCLSAWDSRGI
WMRT
Sequence evidence protein level
Average Mass 5284.16
Monoisotopic Mass 5280.28
Isoelectric Point 12.15
Extinction Coefficient [280nm] 11000.00

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Protein Precursor Mr8.2 precursor (5492)
Nucleic acids
Structure

External links

Tools