Mr103 precursor (P05500) Protein Card

General Information
Name Mr103 precursor
Alternative name(s) Mr103
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class unclassified
Gene superfamily H superfamily
Pharmacological family

Sequence
MNTAGRLLLLCLALGLVFESLG
IPVVDDVEADRDTDPDDGD
PRVVTPGGPRIATGYHVSSAAALQSTGMMNAGKLAVSDLTH
R
GCGMMRVTVQQPLSPEALSWTPNCNVS
Sequence region
[1-22]signal sequence
[84-110]mature peptideMr103

References
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Nucleic acids
Structure

External links

Tools