Conoporin-Cn1 precursor (P05534) Protein Card

General Information
Name Conoporin-Cn1 precursor
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conoporin
Gene superfamily
Pharmacological family

Sequence
MGVQFPALKTMVTVFLLLMGNMSPVVM
KSSIPLRKVKMVAS
KVVTPGSSLYGVALKDLADTSYNITCTLQVENWIRYRLIVP
SVQMVYGVVTTTPIAIEPAKREAFAVRKTSDTASGVAGSVS
WELEKARRRFVIMWSVPDNFNSFGYWMGLGMTREGLVDPDK
DWYGQMYSGSSDGDLTFTRKDFSYNTDSIIYSNDKFEVEGD
MTNTQHAQIKIVIRPSSNNWKDLAPKIRRKLKKKPKPARQR
DN
Sequence evidence protein level
Sequence region
[1-27]signal sequence
[28-249]mature peptideConoporin-Cn1

References
Violette,A., Biass,D., Dutertre,S., Koua,D., Piquemal,D., Pierrat,F. and Favreau,P. (2012) Large-scale discovery of conopeptides and conoproteins in the injectable venom of a fish-hunting cone snail using a combined proteomic and transcriptomic approach. J Proteomics 75:5215-5225

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0DKQ8

Tools