Conoporin-Cn1 (P05535) Protein Card

General Information
Name Conoporin-Cn1
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conoporin-Cn1 precursor (5534)

Classification
Conopeptide class conoporin
Gene superfamily
Pharmacological family

Sequence
KSSIPLRKVKMVASKVVTPGSSLYGVALKDLADTSYNITCT
LQVENWIRYRLIVPSVQMVYGVVTTTPIAIEPAKREAFAVR
KTSDTASGVAGSVSWELEKARRRFVIMWSVPDNFNSFGYWM
GLGMTREGLVDPDKDWYGQMYSGSSDGDLTFTRKDFSYNTD
SIIYSNDKFEVEGDMTNTQHAQIKIVIRPSSNNWKDLAPKI
RRKLKKKPKPARQRDN
Sequence evidence protein level
Average Mass 25031.70
Monoisotopic Mass 25015.87
Isoelectric Point 11.01
Extinction Coefficient [280nm] 46535.00

References
Violette,A., Biass,D., Dutertre,S., Koua,D., Piquemal,D., Pierrat,F. and Favreau,P. (2012) Large-scale discovery of conopeptides and conoproteins in the injectable venom of a fish-hunting cone snail using a combined proteomic and transcriptomic approach. J Proteomics 75:5215-5225

Internal links
Protein Precursor Conoporin-Cn1 precursor (5534)
Nucleic acids
Structure

External links

Tools