conohyal-ad1 precursor (P05536) Protein Card

General Information
Name conohyal-ad1 precursor
Organism Conus adamsonii
Organism region Indo-Pacific
Protein Type Precursor

Classification
Conopeptide class conohyal
Gene superfamily
Pharmacological family

Sequence
MRAVVVVTGLVVVVVTTTLS
LQDHDVKSASSPLSSSVDQGS
SGDDCDEGLPPPDQPFRVVWNHPDNCEKINLHLPLDEYGII
FNKRRVFLGEEIQTLYDTGPWPYINKTGCFINGGLPQLFNQ
PDNSETCKILGKNRIEDFTGLGVLDFETWRAIYSTNFGTME
NYQIESVNLVRKRHPDYSEKELKMVAEQEWQEAARKIMTDK
LAAGQSLMPRGYWGYYLYPRTWDSKPDTKFRNNKIDWLWRQ
STGLYPSIYIYYDVVSKTDSVITKFVSDTVGEAVRQNDFSP
PNTPIYPYVMFQTMDNVFHKEDHMKISLGLSAKMGAAGVIL
WGSSQNYKDFTTQCSRLQ
Sequence region
[1-20]signal sequence
[21-347]mature peptideconohyal-ad1

References
Violette,A., Leonardi,A., Piquemal,D., Terrat,Y., Biass,D., Dutertre,S., Noguier,F., Ducancel,F., Stöcklin,R., Križaj,I. and Favreau,P. (2012) Recruitment of glycosyl hydrolase proteins in a cone snail venomous arsenal: further insights into biomolecular features of Conus venoms. Mar Drugs 10:258-280

Internal links
Nucleic acids conohyal-ad1 precursor, mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot I0CME8

Tools