conohyal-ad1 (P05537) Protein Card

General Information
Name conohyal-ad1
Organism Conus adamsonii
Organism region Indo-Pacific
Protein Type Wild type
Protein precursor conohyal-ad1 precursor (5536)
Notes Putative hyaluronidase activity.

Classification
Conopeptide class conohyal
Gene superfamily
Pharmacological family

Sequence
LQDHDVKSASSPLSSSVDQGSSGDDCDEGLPPPDQPFRVVW
NHPDNCEKINLHLPLDEYGIIFNKRRVFLGEEIQTLYDTGP
WPYINKTGCFINGGLPQLFNQPDNSETCKILGKNRIEDFTG
LGVLDFETWRAIYSTNFGTMENYQIESVNLVRKRHPDYSEK
ELKMVAEQEWQEAARKIMTDKLAAGQSLMPRGYWGYYLYPR
TWDSKPDTKFRNNKIDWLWRQSTGLYPSIYIYYDVVSKTDS
VITKFVSDTVGEAVRQNDFSPPNTPIYPYVMFQTMDNVFHK
EDHMKISLGLSAKMGAAGVILWGSSQNYKDFTTQCSRLQ
Sequence evidence nucleic acid level
Average Mass 37457.16
Monoisotopic Mass 37433.32
Isoelectric Point 6.80
Extinction Coefficient [280nm] 75455.00

References
Violette,A., Leonardi,A., Piquemal,D., Terrat,Y., Biass,D., Dutertre,S., Noguier,F., Ducancel,F., Stöcklin,R., Križaj,I. and Favreau,P. (2012) Recruitment of glycosyl hydrolase proteins in a cone snail venomous arsenal: further insights into biomolecular features of Conus venoms. Mar Drugs 10:258-280

Internal links
Protein Precursor conohyal-ad1 precursor (5536)
Nucleic acids
Structure

External links

Tools