conohyal-Cn1 precursor (P05538) Protein Card

General Information
Name conohyal-Cn1 precursor
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conohyal
Gene superfamily
Pharmacological family

Sequence
MRAVVVVTGLVVVVVATA
LSLPNHDVKSATSSRSSSDYQGS
SGDDCDEGLPPPDQPFRVVWNHPDNCERIKLHLPLDDYGII
FNKLRVFLGEEIQTLYDTGPWPYISETGKFINGGLPQSFNH
PDNDGETQRILKKHRPENFTGLGVLDFETWRAIYSTNFGPM
TIYQNESVKLVKEQHPDYDQKKLTKVAEKEWQQAAKDIMSN
KLKIAQEVMPRGHWGYYLYPRTWDNKRDTKFRNDKINWLWR
QSTGLYPSIYIYDFSKTESAITKFVSDTVGEAVRVQKEFSP
PNTPIYPYVMFQTMDNIFHYEDHLKISLGLSAKMGAAGVVL
WGTSKHYKESTRQWQCQQLQEHIRTVLGPLVKNVTQMMTDC
SRAICEGHGRCVHNSHDVILGETESQRLSDLCSTRQSRFRD
YHCRCYSAWEGACCQTLRPSRCQKREQRNVHGGGDLID
Sequence region
[1-18]signal sequence
[19-448]mature peptideconohyal-Cn1

References
Violette,A., Leonardi,A., Piquemal,D., Terrat,Y., Biass,D., Dutertre,S., Noguier,F., Ducancel,F., Stöcklin,R., Križaj,I. and Favreau,P. (2012) Recruitment of glycosyl hydrolase proteins in a cone snail venomous arsenal: further insights into biomolecular features of Conus venoms. Mar Drugs 10:258-280

Internal links
Nucleic acids conohyal-cn1 precursor, mRNA, complete cds
Structure

External links

Tools