conohyal-Cn1 (P05539) Protein Card

General Information
Name conohyal-Cn1
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor conohyal-Cn1 precursor (5538)
Notes Hyaluronidase activity (Violette 2012).

Classification
Conopeptide class conohyal
Gene superfamily
Pharmacological family

Sequence
LSLPNHDVKSATSSRSSSDYQGSSGDDCDEGLPPPDQPFRV
VWNHPDNCERIKLHLPLDDYGIIFNKLRVFLGEEIQTLYDT
GPWPYISETGKFINGGLPQSFNHPDNDGETQRILKKHRPEN
FTGLGVLDFETWRAIYSTNFGPMTIYQNESVKLVKEQHPDY
DQKKLTKVAEKEWQQAAKDIMSNKLKIAQEVMPRGHWGYYL
YPRTWDNKRDTKFRNDKINWLWRQSTGLYPSIYIYDFSKTE
SAITKFVSDTVGEAVRVQKEFSPPNTPIYPYVMFQTMDNIF
HYEDHLKISLGLSAKMGAAGVVLWGTSKHYKESTRQWQCQQ
LQEHIRTVLGPLVKNVTQMMTDCSRAICEGHGRCVHNSHDV
ILGETESQRLSDLCSTRQSRFRDYHCRCYSAWEGACCQTLR
PSRCQKREQRNVHGGGDLID
Sequence evidence protein level
Average Mass 49661.95
Monoisotopic Mass 49630.36
Isoelectric Point 7.87
Extinction Coefficient [280nm] 90310.00

References
Violette,A., Leonardi,A., Piquemal,D., Terrat,Y., Biass,D., Dutertre,S., Noguier,F., Ducancel,F., Stöcklin,R., Križaj,I. and Favreau,P. (2012) Recruitment of glycosyl hydrolase proteins in a cone snail venomous arsenal: further insights into biomolecular features of Conus venoms. Mar Drugs 10:258-280

Internal links
Protein Precursor conohyal-Cn1 precursor (5538)
Nucleic acids
Structure

External links

Tools