Conodipine-M beta chain (P05540) Protein Card

General Information
Name Conodipine-M beta chain
Organism Conus magus (Magus cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Notes Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Conodipine is composed of two chains, noted alpha and beta chains.

Classification
Conopeptide class conodipine
Gene superfamily
Pharmacological family

Sequence
AATCTHWALIYFKTVQLFGW.HFNYQVDATYCPQFQPCMP.
.
Modified residues
positionsymbolname
21.Any
41.Any
42.Any
Sequence evidence protein level
Average Mass NA
Monoisotopic Mass NA
Isoelectric Point NA
Extinction Coefficient [280nm] NA

References
McIntosh,J.M., Ghomashchi,F., Gelb,M.H., Dooley,D.J., Stoehr,S.J., Giordani,A.B., Naisbitt,S.R. and Olivera,B.M. (1995) Conodipine-M, a novel phospholipase A2 isolated from the venom of the marine snail Conus magus. J. Biol. Chem. 270:3518-3526

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot Q9TWL8

Tools